Lineage for d1zeba_ (1zeb A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905606Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2905607Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2905608Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2905715Protein automated matches [190176] (2 species)
    not a true protein
  7. 2905716Species Human (Homo sapiens) [TaxId:9606] [186907] (7 PDB entries)
  8. 2905722Domain d1zeba_: 1zeb A: [124979]
    automated match to d1ew2a_
    complexed with ca, mg, nag, zn

Details for d1zeba_

PDB Entry: 1zeb (more details), 1.9 Å

PDB Description: x-ray structure of alkaline phosphatase from human placenta in complex with 5'-amp
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1zeba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zeba_ c.76.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iipveeenpdfwnreaaealgaakklqpaqtaaknliiflgdgmgvstvtaarilkgqkk
dklgpeiplamdrfpyvalsktynvdkhvpdsgatataylcgvkgnfqtiglsaaarfnq
cnttrgnevisvmnrakkagksvgvvtttrvqhaspagtyahtvnrnwysdadvpasarq
egcqdiatqlisnmdidvilgggrkymfrmgtpdpeypddysqggtrldgknlvqewlak
rqgaryvwnrtelmqasldpsvthlmglfepgdmkyeihrdstldpslmemteaalrlls
rnprgfflfveggridhghhesrayraltetimfddaieragqltseedtlslvtadhsh
vfsfggyplrgssifglapgkardrkaytvllygngpgyvlkdgarpdvtesesgspeyr
qqsavpldeethagedvavfargpqahlvhgvqeqtfiahvmafaaclepytacdlappa

SCOPe Domain Coordinates for d1zeba_:

Click to download the PDB-style file with coordinates for d1zeba_.
(The format of our PDB-style files is described here.)

Timeline for d1zeba_: