Lineage for d1ze3h1 (1ze3 H:159-279)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789922Protein Mannose-specific adhesin FimH [49406] (1 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 789923Species Escherichia coli [TaxId:562] [49407] (7 PDB entries)
  8. 789925Domain d1ze3h1: 1ze3 H:159-279 [124977]
    Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3d1
    automatically matched to d1kiub2
    complexed with edo

Details for d1ze3h1

PDB Entry: 1ze3 (more details), 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH
PDB Compounds: (H:) FimH PROTEIN

SCOP Domain Sequences for d1ze3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ze3h1 b.2.3.2 (H:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

SCOP Domain Coordinates for d1ze3h1:

Click to download the PDB-style file with coordinates for d1ze3h1.
(The format of our PDB-style files is described here.)

Timeline for d1ze3h1: