SCOP 1.73: Domain d1ze3h1: 1ze3 H:159-279

Lineage for d1ze3h1 (1ze3 H:159-279)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (5 proteins)

6. Protein Mannose-specific adhesin FimH [49406] (1 species)
   duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [49407] (6 PDB entries)

8. Domain d1ze3h1: 1ze3 H:159-279 [124977]
   Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3d1
   automatically matched to d1kiub2
   complexed with edo

Details for d1ze3h1

PDB Entry: 1ze3, 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH

PDB Compounds: (H:) FimH PROTEIN

SCOP Domain Sequences for d1ze3h1:

Sequence; same for both SEQRES and ATOM records:

>d1ze3h1 b.2.3.2 (H:159-279) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
ggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfspa
qgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfvy
q

Timeline for d1ze3h1:

• d1ze3h1 is new in SCOP 1.73
  
• d1ze3h1 appears in SCOP 1.75
  
• d1ze3h1 appears in the current release, SCOPe 2.08, called d1ze3h_