SCOPe 2.08: Domain d1ze3h_: 1ze3 H:

Lineage for d1ze3h_ (1ze3 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species)
   protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand

7. Species Escherichia coli [TaxId:562] [419301] (4 PDB entries)

8. Domain d1ze3h_: 1ze3 H: [124977]
   Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3d1
   automated match to d1ze3h1
   complexed with edo
   missing some secondary structures that made up less than one-third of the common domain

Details for d1ze3h_

PDB Entry: 1ze3, 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH

PDB Compounds: (H:) FimH PROTEIN

SCOPe Domain Sequences for d1ze3h_:

Sequence; same for both SEQRES and ATOM records:

>d1ze3h_ b.2.3.2 (H:) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 562]}
tggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfsp
aqgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfv
yq

Timeline for d1ze3h_:

• d1ze3h_ first appeared in SCOP 1.73, called d1ze3h1
  
• d1ze3h_ appears in SCOPe 2.07