| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
| Protein Mannose-specific adhesin FimH, C-terminal domain [418901] (2 species) protein duplication: consists of two domains of this fold; C-terminal domain lacks the last strand |
| Species Escherichia coli [TaxId:562] [419301] (4 PDB entries) |
| Domain d1ze3h_: 1ze3 H: [124977] Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3d1 automated match to d1ze3h1 complexed with edo missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1ze3 (more details), 1.84 Å
SCOPe Domain Sequences for d1ze3h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ze3h_ b.2.3.2 (H:) Mannose-specific adhesin FimH, C-terminal domain {Escherichia coli [TaxId: 562]}
tggcdvsardvtvtlpdypgsvpipltvycaksqnlgyylsgttadagnsiftntasfsp
aqgvgvqltrngtiipanntvslgavgtsavslgltanyartggqvtagnvqsiigvtfv
yq
Timeline for d1ze3h_: