Lineage for d1ze3d1 (1ze3 D:1-125)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565744Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
    pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368)
  4. 1565745Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) (S)
    automatically mapped to Pfam PF13954
  5. 1565746Family b.167.1.1: Usher N-domain [141730] (1 protein)
    N-terminal part of Pfam PF00577
  6. 1565747Protein Outer membrane usher protein FimD [141731] (1 species)
  7. 1565748Species Escherichia coli [TaxId:562] [141732] (4 PDB entries)
    Uniprot P30130 46-170! Uniprot P30130 70-170! Uniprot P30130 70-184
  8. 1565750Domain d1ze3d1: 1ze3 D:1-125 [124976]
    Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3h_
    complexed with edo

Details for d1ze3d1

PDB Entry: 1ze3 (more details), 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH
PDB Compounds: (D:) Outer membrane usher protein fimD

SCOPe Domain Sequences for d1ze3d1:

Sequence, based on SEQRES records: (download)

>d1ze3d1 b.167.1.1 (D:1-125) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
dlyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgi
vpcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafm
snrar

Sequence, based on observed residues (ATOM records): (download)

>d1ze3d1 b.167.1.1 (D:1-125) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
dlyfnprfllsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraql
asmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafmsnrar

SCOPe Domain Coordinates for d1ze3d1:

Click to download the PDB-style file with coordinates for d1ze3d1.
(The format of our PDB-style files is described here.)

Timeline for d1ze3d1: