SCOP 1.73: Domain d1ze3d1: 1ze3 D:1-125

Lineage for d1ze3d1 (1ze3 D:1-125)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
   pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (scop_sf 50346) and the N-terminal domain of Glutamine synthetase (scop_sf 54368)

4. Superfamily b.167.1: FimD N-terminal domain-like [141729] (1 family)

5. Family b.167.1.1: Usher N-domain [141730] (1 protein)
   N-terminal part of Pfam PF00577

6. Protein Outer membrane usher protein FimD [141731] (1 species)

7. Species Escherichia coli [TaxId:562] [141732] (3 PDB entries)

8. Domain d1ze3d1: 1ze3 D:1-125 [124976]
   Other proteins in same PDB: d1ze3c1, d1ze3c2, d1ze3h1
   complexed with edo

Details for d1ze3d1

PDB Entry: 1ze3, 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH

PDB Compounds: (D:) Outer membrane usher protein fimD

SCOP Domain Sequences for d1ze3d1:

Sequence, based on SEQRES records:

>d1ze3d1 b.167.1.1 (D:1-125) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
dlyfnprfladdpqavadlsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgi
vpcltraqlasmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafm
snrar

Sequence, based on observed residues (ATOM records):

>d1ze3d1 b.167.1.1 (D:1-125) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
dlyfnprfllsrfengqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraql
asmglntasvagmnlladdacvplttmvqdatahldvgqqrlnltipqafmsnrar

Timeline for d1ze3d1:

• d1ze3d1 is new in SCOP 1.73
  
• d1ze3d1 appears in SCOP 1.75
  
• d1ze3d1 appears in the current release, SCOPe 2.08