SCOPe 2.08: Domain d1ze3c2: 1ze3 C:122-205

Lineage for d1ze3c2 (1ze3 C:122-205)

1. Root: SCOPe 2.08
2. Class b: All beta proteins [48724] (180 folds)
3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key
4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)
5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
6. Protein FimC [49588] (1 species)
7. Species Escherichia coli [TaxId:562] [49589] (9 PDB entries)
8. Domain d1ze3c2: 1ze3 C:122-205 [124975]
   Other proteins in same PDB: d1ze3c1, d1ze3d1, d1ze3h_
   automated match to d1bf8a2
   complexed with edo

Details for d1ze3c2

PDB Entry: 1ze3, 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d1ze3c2:

Sequence; same for both SEQRES and ATOM records:

>d1ze3c2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]}
lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda
gsnityrtindygaltpkmtgvme

SCOPe Domain Coordinates for d1ze3c2 are not available.

Timeline for d1ze3c2:

• d1ze3c2 first appeared in SCOP 1.73
  
• d1ze3c2 appears in SCOPe 2.07