Lineage for d1ze3c1 (1ze3 C:1-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788734Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 788735Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 788747Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 788748Species Escherichia coli [TaxId:562] [49359] (6 PDB entries)
  8. 788750Domain d1ze3c1: 1ze3 C:1-121 [124974]
    Other proteins in same PDB: d1ze3c2, d1ze3d1, d1ze3h1
    automatically matched to d1bf8_1
    complexed with edo

Details for d1ze3c1

PDB Entry: 1ze3 (more details), 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH
PDB Compounds: (C:) chaperone protein fimc

SCOP Domain Sequences for d1ze3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ze3c1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1ze3c1:

Click to download the PDB-style file with coordinates for d1ze3c1.
(The format of our PDB-style files is described here.)

Timeline for d1ze3c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ze3c2