SCOPe 2.07: Domain d1ze2b2: 1ze2 B:1-228

Lineage for d1ze2b2 (1ze2 B:1-228)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries)

8. Domain d1ze2b2: 1ze2 B:1-228 [124973]
   Other proteins in same PDB: d1ze2a1, d1ze2b1
   automatically matched to d1r3ea2
   protein/RNA complex

Details for d1ze2b2

PDB Entry: 1ze2, 3 Å

PDB Description: Conformational change of pseudouridine 55 synthase upon its association with RNA substrate

PDB Compounds: (B:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1ze2b2:

Sequence, based on SEQRES records:

>d1ze2b2 d.265.1.2 (B:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew

Sequence, based on observed residues (ATOM records):

>d1ze2b2 d.265.1.2 (B:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvygeydqvppaysakkykgerlyklaregkiinlppkrvkifkirvevspgtyir
vresvgphtieeslnvfeaapeeienriiplekclew

Timeline for d1ze2b2:

• d1ze2b2 first appeared in SCOP 1.73
  
• d1ze2b2 appears in SCOPe 2.06
  
• d1ze2b2 appears in the current release, SCOPe 2.08