![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
![]() | Protein Pseudouridine synthase II TruB [69747] (5 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries) |
![]() | Domain d1ze2b2: 1ze2 B:1-228 [124973] Other proteins in same PDB: d1ze2a1, d1ze2b1 automatically matched to d1r3ea2 protein/RNA complex fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1ze2 (more details), 3 Å
SCOPe Domain Sequences for d1ze2b2:
Sequence, based on SEQRES records: (download)
>d1ze2b2 d.265.1.2 (B:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]} mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew
>d1ze2b2 d.265.1.2 (B:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]} mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy kdlkkvygeydqvppaysakkykgerlyklaregkiinlppkrvkifkirvevspgtyir vresvgphtieeslnvfeaapeeienriiplekclew
Timeline for d1ze2b2: