Class b: All beta proteins [48724] (177 folds) |
Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (14 families) |
Family b.122.1.1: PUA domain [88698] (6 proteins) RNA-binding domain |
Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species) |
Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries) |
Domain d1ze2b1: 1ze2 B:229-308 [124972] Other proteins in same PDB: d1ze2a2, d1ze2b2 automatically matched to d1r3ea1 protein/RNA complex |
PDB Entry: 1ze2 (more details), 3 Å
SCOPe Domain Sequences for d1ze2b1:
Sequence, based on SEQRES records: (download)
>d1ze2b1 b.122.1.1 (B:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle tlrkherqervltlrkvfqt
>d1ze2b1 b.122.1.1 (B:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernrkvfq t
Timeline for d1ze2b1: