SCOP 1.73: Domain d1ze2a1: 1ze2 A:229-308

Lineage for d1ze2a1 (1ze2 A:229-308)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (10 families)

5. Family b.122.1.1: PUA domain [88698] (5 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries)

8. Domain d1ze2a1: 1ze2 A:229-308 [124970]
   Other proteins in same PDB: d1ze2a2, d1ze2b2
   automatically matched to d1r3ea1
   complexed with fhu

Details for d1ze2a1

PDB Entry: 1ze2, 3 Å

PDB Description: Conformational change of pseudouridine 55 synthase upon its association with RNA substrate

PDB Compounds: (A:) tRNA pseudouridine synthase B

SCOP Domain Sequences for d1ze2a1:

Sequence, based on SEQRES records:

>d1ze2a1 b.122.1.1 (A:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkherqervltlrkvfqt

Sequence, based on observed residues (ATOM records):

>d1ze2a1 b.122.1.1 (A:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfrq
ervltlrkvfqt

Timeline for d1ze2a1:

• d1ze2a1 is new in SCOP 1.73
  
• d1ze2a1 appears in SCOP 1.75
  
• d1ze2a1 appears in the current release, SCOPe 2.08