SCOP 1.75: Domain d1ze1d1: 1ze1 D:229-308

Lineage for d1ze1d1 (1ze1 D:229-308)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (13 families)

5. Family b.122.1.1: PUA domain [88698] (6 proteins)
   RNA-binding domain

6. Protein Pseudouridine synthase II TruB, C-terminal domain [88699] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [102023] (4 PDB entries)

8. Domain d1ze1d1: 1ze1 D:229-308 [124968]
   Other proteins in same PDB: d1ze1a2, d1ze1b2, d1ze1c2, d1ze1d2
   automatically matched to d1r3ea1
   complexed with mg

Details for d1ze1d1

PDB Entry: 1ze1, 2.9 Å

PDB Description: Conformational Change of Pseudouridine 55 Synthase upon Its Association with RNA Substrate

PDB Compounds: (D:) tRNA pseudouridine synthase B

SCOP Domain Sequences for d1ze1d1:

Sequence; same for both SEQRES and ATOM records:

>d1ze1d1 b.122.1.1 (D:229-308) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lprvvvhqestkmilngsqihlemlkewdgfkkgevvrvfneegrllalaeaernssfle
tlrkherqrrvltlrkvfqt

Timeline for d1ze1d1:

• d1ze1d1 first appeared in SCOP 1.73
  
• d1ze1d1 appears in SCOPe 2.01
  
• d1ze1d1 appears in the current release, SCOPe 2.08