Lineage for d1ze1c2 (1ze1 C:1-228)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741101Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 741102Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 741117Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 741118Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 741132Species Thermotoga maritima [TaxId:2336] [103016] (4 PDB entries)
  8. 741137Domain d1ze1c2: 1ze1 C:1-228 [124967]
    Other proteins in same PDB: d1ze1a1, d1ze1b1, d1ze1c1, d1ze1d1
    automatically matched to d1r3ea2
    complexed with mg

Details for d1ze1c2

PDB Entry: 1ze1 (more details), 2.9 Å

PDB Description: Conformational Change of Pseudouridine 55 Synthase upon Its Association with RNA Substrate
PDB Compounds: (C:) tRNA pseudouridine synthase B

SCOP Domain Sequences for d1ze1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ze1c2 d.265.1.2 (C:1-228) Pseudouridine synthase II TruB {Thermotoga maritima [TaxId: 2336]}
mkhgilvaykpkgptshdvvdevrkklktrkvghggtldpfacgvliigvnqgtrilefy
kdlkkvywvkmrlglitetfditgevveerecnvteeeireaifsfvgeydqvppaysak
kykgerlyklaregkiinlppkrvkifkiwdvniegrdvsfrvevspgtyirslcmdigy
klgcgatavelvresvgphtieeslnvfeaapeeienriiplekclew

SCOP Domain Coordinates for d1ze1c2:

Click to download the PDB-style file with coordinates for d1ze1c2.
(The format of our PDB-style files is described here.)

Timeline for d1ze1c2: