SCOPe 2.07: Domain d1zdya_: 1zdy A:

Lineage for d1zdya_ (1zdy A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.313: Antiparallel beta/alpha barrel (PT-barrel) [143491] (1 superfamily)
   tandem repeat of five alpha(2)-beta(2) motifs; antiparallel beta-sheet barrel, closed; n=10, S=10; order 123456789A; there is a channel along the barrel axis

4. Superfamily d.313.1: Prenyltransferase-like [143492] (2 families)
   the barrel channel harbours the substrate-binding site

5. Family d.313.1.1: Prenyltransferase-like [143493] (1 protein)
   automatically mapped to Pfam PF11468

6. Protein Aromatic prenyltransferase [143494] (1 species)

7. Species Streptomyces sp. CL190 [TaxId:93372] [143495] (4 PDB entries)
   Uniprot Q4R2T2 3-303

8. Domain d1zdya_: 1zdy A: [124961]
   automated match to d1zb6a1
   complexed with t3a

Details for d1zdya_

PDB Entry: 1zdy, 1.44 Å

PDB Description: Co-crystal structure of Orf2 an aromatic prenyl transferase from Streptomyces sp. strain CL190 complexed with TAPS

PDB Compounds: (A:) Aromatic prenyltransferase

SCOPe Domain Sequences for d1zdya_:

Sequence; same for both SEQRES and ATOM records:

>d1zdya_ d.313.1.1 (A:) Aromatic prenyltransferase {Streptomyces sp. CL190 [TaxId: 93372]}
eaadvervyaameeaagllgvacardkiypllstfqdtlveggsvvvfsmasgrhsteld
fsisvptshgdpyatvvekglfpatghpvddlladtqkhlpvsmfaidgevtggfkktya
ffptdnmpgvaelsaipsmppavaenaelfarygldkvqmtsmdykkrqvnlyfselsaq
tleaesvlalvrelglhvpnelglkfckrsfsvyptlnwetgkidrlcfavisndptlvp
ssdegdiekfhnyatkapyayvgekrtlvygltlspkeeyyklgayyhitdvqrgllkaf
d

Timeline for d1zdya_:

• d1zdya_ first appeared in SCOP 1.73, called d1zdya1
  
• d1zdya_ appears in SCOPe 2.06
  
• d1zdya_ appears in the current release, SCOPe 2.08