Lineage for d1zdva1 (1zdv A:25-139)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 681070Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
    pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (scop_sf 50346) and the N-terminal domain of Glutamine synthetase (scop_sf 54368)
  4. 681071Superfamily b.167.1: FimD N-terminal domain-like [141729] (1 family) (S)
  5. 681072Family b.167.1.1: Usher N-domain [141730] (1 protein)
    N-terminal part of Pfam PF00577
  6. 681073Protein Outer membrane usher protein FimD [141731] (1 species)
  7. 681074Species Escherichia coli [TaxId:562] [141732] (3 PDB entries)
  8. 681076Domain d1zdva1: 1zdv A:25-139 [124958]

Details for d1zdva1

PDB Entry: 1zdv (more details)

PDB Description: solution structure of the type 1 pilus assembly platform fimd(25-139)
PDB Compounds: (A:) Outer membrane usher protein fimD

SCOP Domain Sequences for d1zdva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdva1 b.167.1.1 (A:25-139) Outer membrane usher protein FimD {Escherichia coli [TaxId: 562]}
gqelppgtyrvdiylnngymatrdvtfntgdseqgivpcltraqlasmglntasvagmnl
laddacvplttmvqdatahldvgqqrlnltipqafmsnrargyippelwdpgina

SCOP Domain Coordinates for d1zdva1:

Click to download the PDB-style file with coordinates for d1zdva1.
(The format of our PDB-style files is described here.)

Timeline for d1zdva1: