Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (37 PDB entries) Uniprot P38501 |
Domain d1zdsb1: 1zds B:12-164 [124954] automatically matched to d1ndra1 complexed with acm, cu |
PDB Entry: 1zds (more details), 1.55 Å
SCOPe Domain Sequences for d1zdsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zdsb1 b.6.1.3 (B:12-164) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} lprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpgp lmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpgv fvyhcappgmvpwhvvsggngaimvlpreglhd
Timeline for d1zdsb1:
View in 3D Domains from other chains: (mouse over for more information) d1zdsa1, d1zdsa2, d1zdsc1, d1zdsc2 |