SCOPe 2.03: Domain d1zdsb1: 1zds B:12-164

Lineage for d1zdsb1 (1zds B:12-164)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (37 PDB entries)
   Uniprot P38501

8. Domain d1zdsb1: 1zds B:12-164 [124954]
   automatically matched to d1ndra1
   complexed with acm, cu

Details for d1zdsb1

PDB Entry: 1zds, 1.55 Å

PDB Description: crystal structure of met150gly afnir with acetamide bound

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1zdsb1:

Sequence; same for both SEQRES and ATOM records:

>d1zdsb1 b.6.1.3 (B:12-164) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
lprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamafngtvpgp
lmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrfkatkpgv
fvyhcappgmvpwhvvsggngaimvlpreglhd

Timeline for d1zdsb1:

• d1zdsb1 first appeared in SCOP 1.73
  
• d1zdsb1 appears in SCOPe 2.02
  
• d1zdsb1 appears in SCOPe 2.04
  
• d1zdsb1 appears in the current release, SCOPe 2.08