Lineage for d1zdqc2 (1zdq C:167-337)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661004Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 661165Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries)
  8. 661199Domain d1zdqc2: 1zdq C:167-337 [124951]
    automatically matched to d1ndra2
    complexed with cu, msm; mutant

Details for d1zdqc2

PDB Entry: 1zdq (more details), 1.8 Å

PDB Description: Crystal Structure of Met150Gly AfNiR with Methylsulfanyl Methane Bound
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOP Domain Sequences for d1zdqc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdqc2 b.6.1.3 (C:167-337) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap

SCOP Domain Coordinates for d1zdqc2:

Click to download the PDB-style file with coordinates for d1zdqc2.
(The format of our PDB-style files is described here.)

Timeline for d1zdqc2: