SCOP 1.73: Domain d1zdqc2: 1zdq C:167-337

Lineage for d1zdqc2 (1zdq C:167-337)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (26 PDB entries)

8. Domain d1zdqc2: 1zdq C:167-337 [124951]
   automatically matched to d1ndra2
   complexed with cu, msm; mutant

Details for d1zdqc2

PDB Entry: 1zdq, 1.8 Å

PDB Description: crystal structure of met150gly afnir with methylsulfanyl methane bound

PDB Compounds: (C:) Copper-containing nitrite reductase

SCOP Domain Sequences for d1zdqc2:

Sequence; same for both SEQRES and ATOM records:

>d1zdqc2 b.6.1.3 (C:167-337) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap

Timeline for d1zdqc2:

• d1zdqc2 is new in SCOP 1.73
  
• d1zdqc2 appears in SCOP 1.75
  
• d1zdqc2 appears in the current release, SCOPe 2.08