Lineage for d1zdnb1 (1zdn B:10-156)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857031Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 857032Superfamily d.20.1: UBC-like [54495] (4 families) (S)
  5. 857033Family d.20.1.1: UBC-related [54496] (6 proteins)
  6. 857041Protein Ubiquitin conjugating enzyme, UBC [54497] (32 species)
  7. 857149Species Human(Homo sapiens), E2 S [TaxId:9606] [143048] (1 PDB entry)
    Uniprot Q16763 6-156
  8. 857151Domain d1zdnb1: 1zdn B:10-156 [124944]
    automatically matched to 1ZDN A:6-156
    complexed with na

Details for d1zdnb1

PDB Entry: 1zdn (more details), 1.93 Å

PDB Description: Ubiquitin-conjugating enzyme E2S
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2S

SCOP Domain Sequences for d1zdnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdnb1 d.20.1.1 (B:10-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]}
phiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmklllgkd
fpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnpesal
neeagrlllenyeeyaararllteihg

SCOP Domain Coordinates for d1zdnb1:

Click to download the PDB-style file with coordinates for d1zdnb1.
(The format of our PDB-style files is described here.)

Timeline for d1zdnb1: