Lineage for d1zdnb_ (1zdn B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508149Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2508150Protein automated matches [190120] (8 species)
    not a true protein
  7. 2508155Species Human (Homo sapiens) [TaxId:9606] [186843] (20 PDB entries)
  8. 2508156Domain d1zdnb_: 1zdn B: [124944]
    Other proteins in same PDB: d1zdna1
    automated match to d1jata_
    complexed with na

Details for d1zdnb_

PDB Entry: 1zdn (more details), 1.93 Å

PDB Description: Ubiquitin-conjugating enzyme E2S
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2S

SCOPe Domain Sequences for d1zdnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdnb_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmklllgkd
fpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnpesal
neeagrlllenyeeyaararllteihg

SCOPe Domain Coordinates for d1zdnb_:

Click to download the PDB-style file with coordinates for d1zdnb_.
(The format of our PDB-style files is described here.)

Timeline for d1zdnb_: