SCOPe 2.08: Domain d1zdnb_: 1zdn B:

Lineage for d1zdnb_ (1zdn B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.0: automated matches [191322] (1 protein)
   not a true family

6. Protein automated matches [190120] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)

8. Domain d1zdnb_: 1zdn B: [124944]
   Other proteins in same PDB: d1zdna1
   automated match to d1jata_
   complexed with na

Details for d1zdnb_

PDB Entry: 1zdn, 1.93 Å

PDB Description: Ubiquitin-conjugating enzyme E2S

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2S

SCOPe Domain Sequences for d1zdnb_:

Sequence; same for both SEQRES and ATOM records:

>d1zdnb_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmklllgkd
fpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnpesal
neeagrlllenyeeyaararllteihg

Timeline for d1zdnb_:

• d1zdnb_ first appeared in SCOP 1.73, called d1zdnb1
  
• d1zdnb_ appears in SCOPe 2.07