Lineage for d1zdna1 (1zdn A:6-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546107Species Human (Homo sapiens), E2 S [TaxId:9606] [143048] (1 PDB entry)
    Uniprot Q16763 6-156
  8. 2546108Domain d1zdna1: 1zdn A:6-156 [124943]
    Other proteins in same PDB: d1zdnb_
    complexed with na

Details for d1zdna1

PDB Entry: 1zdn (more details), 1.93 Å

PDB Description: Ubiquitin-conjugating enzyme E2S
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2S

SCOPe Domain Sequences for d1zdna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 S [TaxId: 9606]}
enlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmkll
lgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnp
esalneeagrlllenyeeyaararllteihg

SCOPe Domain Coordinates for d1zdna1:

Click to download the PDB-style file with coordinates for d1zdna1.
(The format of our PDB-style files is described here.)

Timeline for d1zdna1: