Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), E2 S [TaxId:9606] [143048] (1 PDB entry) Uniprot Q16763 6-156 |
Domain d1zdna1: 1zdn A:6-156 [124943] Other proteins in same PDB: d1zdnb_ complexed with na |
PDB Entry: 1zdn (more details), 1.93 Å
SCOPe Domain Sequences for d1zdna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 S [TaxId: 9606]} enlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmkll lgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnp esalneeagrlllenyeeyaararllteihg
Timeline for d1zdna1: