SCOP 1.73: Domain d1zdna1: 1zdn A:6-156

Lineage for d1zdna1 (1zdn A:6-156)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.1: UBC-related [54496] (6 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (31 species)

7. Species Human(Homo sapiens), E2 S [TaxId:9606] [143048] (1 PDB entry)

8. Domain d1zdna1: 1zdn A:6-156 [124943]
   complexed with na

Details for d1zdna1

PDB Entry: 1zdn, 1.93 Å

PDB Description: Ubiquitin-conjugating enzyme E2S

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2S

SCOP Domain Sequences for d1zdna1:

Sequence; same for both SEQRES and ATOM records:

>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]}
enlpphiirlvykevttltadppdgikvfpneedltdlqvtiegpegtpyagglfrmkll
lgkdfpasppkgyfltkifhpnvgangeicvnvlkrdwtaelgirhvlltikcllihpnp
esalneeagrlllenyeeyaararllteihg

Timeline for d1zdna1:

• d1zdna1 is new in SCOP 1.73
  
• d1zdna1 appears in SCOP 1.75
  
• d1zdna1 appears in the current release, SCOPe 2.08