Lineage for d1zd9a1 (1zd9 A:17-181)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2474876Protein ADP-ribosylation factor [52614] (16 species)
  7. 2474936Species Human (Homo sapiens), ARL8A [TaxId:9606] [142219] (1 PDB entry)
    Uniprot Q96BM9 18-181
  8. 2474937Domain d1zd9a1: 1zd9 A:17-181 [124938]
    Other proteins in same PDB: d1zd9a2
    complexed with gdp, mg

Details for d1zd9a1

PDB Entry: 1zd9 (more details), 1.7 Å

PDB Description: Structure of human ADP-ribosylation factor-like 10B
PDB Compounds: (A:) ADP-ribosylation factor-like 10B

SCOPe Domain Sequences for d1zd9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd9a1 c.37.1.8 (A:17-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}
keemeltlvglqysgkttfvnviasgqfnedmiptvgfnmrkitkgnvtiklwdiggqpr
frsmwerycrgvsaivymvdaadqekieasknelhnlldkpqlqgipvlvlgnkrdlpga
ldekeliekmnlsaiqdreiccysisckekdniditlqwliqhsk

SCOPe Domain Coordinates for d1zd9a1:

Click to download the PDB-style file with coordinates for d1zd9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zd9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zd9a2