![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein ADP-ribosylation factor [52614] (14 species) |
![]() | Species Human (Homo sapiens), ARL8A [TaxId:9606] [142219] (1 PDB entry) |
![]() | Domain d1zd9a1: 1zd9 A:18-181 [124938] complexed with gdp, mg |
PDB Entry: 1zd9 (more details), 1.7 Å
SCOP Domain Sequences for d1zd9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} eemeltlvglqysgkttfvnviasgqfnedmiptvgfnmrkitkgnvtiklwdiggqprf rsmwerycrgvsaivymvdaadqekieasknelhnlldkpqlqgipvlvlgnkrdlpgal dekeliekmnlsaiqdreiccysisckekdniditlqwliqhsk
Timeline for d1zd9a1: