SCOPe 2.08: Domain d1zd9a1: 1zd9 A:17-181

Lineage for d1zd9a1 (1zd9 A:17-181)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (17 species)

7. Species Human (Homo sapiens), ARL8A [TaxId:9606] [142219] (1 PDB entry)
   Uniprot Q96BM9 18-181

8. Domain d1zd9a1: 1zd9 A:17-181 [124938]
   Other proteins in same PDB: d1zd9a2
   complexed with gdp, mg

Details for d1zd9a1

PDB Entry: 1zd9, 1.7 Å

PDB Description: Structure of human ADP-ribosylation factor-like 10B

PDB Compounds: (A:) ADP-ribosylation factor-like 10B

SCOPe Domain Sequences for d1zd9a1:

Sequence; same for both SEQRES and ATOM records:

>d1zd9a1 c.37.1.8 (A:17-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}
keemeltlvglqysgkttfvnviasgqfnedmiptvgfnmrkitkgnvtiklwdiggqpr
frsmwerycrgvsaivymvdaadqekieasknelhnlldkpqlqgipvlvlgnkrdlpga
ldekeliekmnlsaiqdreiccysisckekdniditlqwliqhsk

Timeline for d1zd9a1:

• d1zd9a1 first appeared in SCOP 1.73
  
• d1zd9a1 appears in SCOPe 2.07