Lineage for d1zd6b1 (1zd6 B:10-124)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 659956Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family) (S)
  5. 659957Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)
  6. 659958Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 659979Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)
  8. 660045Domain d1zd6b1: 1zd6 B:10-124 [124937]
    automatically matched to d1bzda_
    complexed with cl

Details for d1zd6b1

PDB Entry: 1zd6 (more details), 1.9 Å

PDB Description: Crystal structure of human transthyretin with bound chloride
PDB Compounds: (B:) Transthyretin

SCOP Domain Sequences for d1zd6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd6b1 b.3.4.1 (B:10-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOP Domain Coordinates for d1zd6b1:

Click to download the PDB-style file with coordinates for d1zd6b1.
(The format of our PDB-style files is described here.)

Timeline for d1zd6b1: