SCOP 1.73: Domain d1zd6a1: 1zd6 A:10-124

Lineage for d1zd6a1 (1zd6 A:10-124)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (67 PDB entries)

8. Domain d1zd6a1: 1zd6 A:10-124 [124936]
   automatically matched to d1bzda_
   complexed with cl

Details for d1zd6a1

PDB Entry: 1zd6, 1.9 Å

PDB Description: Crystal structure of human transthyretin with bound chloride

PDB Compounds: (A:) Transthyretin

SCOP Domain Sequences for d1zd6a1:

Sequence; same for both SEQRES and ATOM records:

>d1zd6a1 b.3.4.1 (A:10-124) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d1zd6a1:

• d1zd6a1 is new in SCOP 1.73
  
• d1zd6a1 appears in SCOP 1.75
  
• d1zd6a1 appears in the current release, SCOPe 2.08, called d1zd6a_