![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
![]() | Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102626] (41 PDB entries) |
![]() | Domain d1zd5a2: 1zd5 A:226-547 [124935] Other proteins in same PDB: d1zd5a1 automated match to d1vj5a2 complexed with mg, nc7, po4 |
PDB Entry: 1zd5 (more details), 2.6 Å
SCOPe Domain Sequences for d1zd5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zd5a2 c.69.1.11 (A:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq mdkptevnqilikwldsdarn
Timeline for d1zd5a2: