Lineage for d1zd5a2 (1zd5 A:226-547)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508005Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2508019Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 2508020Species Human (Homo sapiens) [TaxId:9606] [102626] (41 PDB entries)
  8. 2508047Domain d1zd5a2: 1zd5 A:226-547 [124935]
    Other proteins in same PDB: d1zd5a1
    automated match to d1vj5a2
    complexed with mg, nc7, po4

Details for d1zd5a2

PDB Entry: 1zd5 (more details), 2.6 Å

PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-heptanoic acid complex
PDB Compounds: (A:) epoxide hydrolase 2, cytoplasmic

SCOPe Domain Sequences for d1zd5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd5a2 c.69.1.11 (A:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn

SCOPe Domain Coordinates for d1zd5a2:

Click to download the PDB-style file with coordinates for d1zd5a2.
(The format of our PDB-style files is described here.)

Timeline for d1zd5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zd5a1