SCOP 1.73: Domain d1zd5a1: 1zd5 A:2-224

Lineage for d1zd5a1 (1zd5 A:2-224)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: YihX-like [56789] (2 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Human (Homo sapiens) [TaxId:9606] [102303] (6 PDB entries)

8. Domain d1zd5a1: 1zd5 A:2-224 [124934]
   Other proteins in same PDB: d1zd5a2
   automatically matched to d1vj5a1
   complexed with mg, nc7, po4

Details for d1zd5a1

PDB Entry: 1zd5, 2.6 Å

PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-heptanoic acid complex

PDB Compounds: (A:) epoxide hydrolase 2, cytoplasmic

SCOP Domain Sequences for d1zd5a1:

Sequence; same for both SEQRES and ATOM records:

>d1zd5a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpa

Timeline for d1zd5a1:

• d1zd5a1 is new in SCOP 1.73
  
• d1zd5a1 appears in SCOP 1.75
  
• d1zd5a1 appears in the current release, SCOPe 2.08