Lineage for d1zd3a1 (1zd3 A:2-224)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712216Family c.108.1.2: YihX-like [56789] (2 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 712217Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 712218Species Human (Homo sapiens) [TaxId:9606] [102303] (6 PDB entries)
  8. 712219Domain d1zd3a1: 1zd3 A:2-224 [124930]
    Other proteins in same PDB: d1zd3a2
    automatically matched to d1vj5a1
    complexed with 15p, mg, nc4, po4

Details for d1zd3a1

PDB Entry: 1zd3 (more details), 2.3 Å

PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-butyric acid complex
PDB Compounds: (A:) epoxide hydrolase 2, cytoplasmic

SCOP Domain Sequences for d1zd3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpa

SCOP Domain Coordinates for d1zd3a1:

Click to download the PDB-style file with coordinates for d1zd3a1.
(The format of our PDB-style files is described here.)

Timeline for d1zd3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zd3a2