SCOPe 2.06: Domain d1zd2p2: 1zd2 P:226-547

Lineage for d1zd2p2 (1zd2 P:226-547)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)

6. Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102626] (40 PDB entries)

8. Domain d1zd2p2: 1zd2 P:226-547 [124929]
   Other proteins in same PDB: d1zd2p1
   automated match to d3i28a2
   complexed with mg, nc3, po4

Details for d1zd2p2

PDB Entry: 1zd2, 3 Å

PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-ethanoic acid complex

PDB Compounds: (P:) epoxide hydrolase 2, cytoplasmic

SCOPe Domain Sequences for d1zd2p2:

Sequence; same for both SEQRES and ATOM records:

>d1zd2p2 c.69.1.11 (P:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn

Timeline for d1zd2p2:

• d1zd2p2 first appeared in SCOP 1.73
  
• d1zd2p2 appears in SCOPe 2.05
  
• d1zd2p2 appears in SCOPe 2.07
  
• d1zd2p2 appears in the current release, SCOPe 2.08