Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102626] (40 PDB entries) |
Domain d1zd2p2: 1zd2 P:226-547 [124929] Other proteins in same PDB: d1zd2p1 automated match to d3i28a2 complexed with mg, nc3, po4 |
PDB Entry: 1zd2 (more details), 3 Å
SCOPe Domain Sequences for d1zd2p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zd2p2 c.69.1.11 (P:226-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq mdkptevnqilikwldsdarn
Timeline for d1zd2p2: