Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.2: YihX-like [56789] (3 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
Protein Epoxide hydrolase, N-terminal domain [56790] (2 species) has a lipid phosphatase activity |
Species Human (Homo sapiens) [TaxId:9606] [102303] (35 PDB entries) |
Domain d1zd2p1: 1zd2 P:2-225 [124928] Other proteins in same PDB: d1zd2p2 automated match to d1zd3a1 complexed with mg, nc3, po4 |
PDB Entry: 1zd2 (more details), 3 Å
SCOPe Domain Sequences for d1zd2p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zd2p1 c.108.1.2 (P:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap
Timeline for d1zd2p1: