Lineage for d1zd2p1 (1zd2 P:2-225)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919509Family c.108.1.2: YihX-like [56789] (3 proteins)
    the insertion subdomain is a 4-helical bundle
    automatically mapped to Pfam PF13419
  6. 2919510Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 2919511Species Human (Homo sapiens) [TaxId:9606] [102303] (36 PDB entries)
  8. 2919539Domain d1zd2p1: 1zd2 P:2-225 [124928]
    Other proteins in same PDB: d1zd2p2
    automated match to d1zd3a1
    complexed with mg, nc3, po4

Details for d1zd2p1

PDB Entry: 1zd2 (more details), 3 Å

PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-ethanoic acid complex
PDB Compounds: (P:) epoxide hydrolase 2, cytoplasmic

SCOPe Domain Sequences for d1zd2p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd2p1 c.108.1.2 (P:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

SCOPe Domain Coordinates for d1zd2p1:

Click to download the PDB-style file with coordinates for d1zd2p1.
(The format of our PDB-style files is described here.)

Timeline for d1zd2p1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zd2p2