SCOPe 2.08: Domain d1zd2p1: 1zd2 P:2-225

Lineage for d1zd2p1 (1zd2 P:2-225)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: YihX-like [56789] (3 proteins)
   the insertion subdomain is a 4-helical bundle
   automatically mapped to Pfam PF13419

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Human (Homo sapiens) [TaxId:9606] [102303] (36 PDB entries)

8. Domain d1zd2p1: 1zd2 P:2-225 [124928]
   Other proteins in same PDB: d1zd2p2
   automated match to d1zd3a1
   complexed with mg, nc3, po4

Details for d1zd2p1

PDB Entry: 1zd2, 3 Å

PDB Description: Human soluble epoxide hydrolase 4-(3-cyclohexyluriedo)-ethanoic acid complex

PDB Compounds: (P:) epoxide hydrolase 2, cytoplasmic

SCOPe Domain Sequences for d1zd2p1:

Sequence; same for both SEQRES and ATOM records:

>d1zd2p1 c.108.1.2 (P:2-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitls
qwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttai
ltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevv
flddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap

Timeline for d1zd2p1:

• d1zd2p1 first appeared in SCOP 1.73
  
• d1zd2p1 appears in SCOPe 2.07