![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
![]() | Family c.24.1.3: Inosicase [63971] (1 protein) |
![]() | Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142081] (1 PDB entry) Uniprot Q9X0X6 1-157 |
![]() | Domain d1zczb1: 1zcz B:1-157 [124925] Other proteins in same PDB: d1zcza2, d1zczb2, d1zczb3 automated match to d1zcza1 complexed with k, pg4 |
PDB Entry: 1zcz (more details), 1.88 Å
SCOPe Domain Sequences for d1zczb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zczb1 c.24.1.3 (B:1-157) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} mkrilvslyekekyldilrelhekgweiwassgtakflksngieandvstitgfenllgg lvktlhpeifagilgpeprwdvvfvdlypppdidiggvallraaaknwkkvkpafdmetl klaieiddeetrkylagmtfaftsvydsiranqfveg
Timeline for d1zczb1: