![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (2 proteins) duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs |
![]() | Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [142844] (1 PDB entry) Uniprot Q9X0X6 158-452 |
![]() | Domain d1zcza2: 1zcz A:158-452 [124924] Other proteins in same PDB: d1zcza1, d1zczb1, d1zczb3 complexed with k, pg4 |
PDB Entry: 1zcz (more details), 1.88 Å
SCOPe Domain Sequences for d1zcza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcza2 c.97.1.4 (A:158-452) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} islafkredlqlrygenphekafvygkpafeilhegktisfnnildaenawfmaknlprm gavvvkhqspcgaaigedkveivkkaieaddessfggilavnfemdeevakslkkylevi vapsftqeaievlskkkvrllkpgdyaswagkmafgslvlserkypegnfelvvgeplse keledlefayrvvegaksnavliakdgvtvgigsgqpsrkraawiatvmagekakgavaa sdaffpfpdsleilaqagvkavvaplgsirdeeviekarelgitfykapsrvfrh
Timeline for d1zcza2: