Lineage for d1zcza2 (1zcz A:158-452)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2147805Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2147972Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 2147973Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)
  7. 2148006Species Thermotoga maritima [TaxId:2336] [142844] (1 PDB entry)
    Uniprot Q9X0X6 158-452
  8. 2148007Domain d1zcza2: 1zcz A:158-452 [124924]
    Other proteins in same PDB: d1zcza1, d1zczb1, d1zczb3
    complexed with k, pg4

Details for d1zcza2

PDB Entry: 1zcz (more details), 1.88 Å

PDB Description: crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution
PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1zcza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcza2 c.97.1.4 (A:158-452) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]}
islafkredlqlrygenphekafvygkpafeilhegktisfnnildaenawfmaknlprm
gavvvkhqspcgaaigedkveivkkaieaddessfggilavnfemdeevakslkkylevi
vapsftqeaievlskkkvrllkpgdyaswagkmafgslvlserkypegnfelvvgeplse
keledlefayrvvegaksnavliakdgvtvgigsgqpsrkraawiatvmagekakgavaa
sdaffpfpdsleilaqagvkavvaplgsirdeeviekarelgitfykapsrvfrh

SCOPe Domain Coordinates for d1zcza2:

Click to download the PDB-style file with coordinates for d1zcza2.
(The format of our PDB-style files is described here.)

Timeline for d1zcza2: