Lineage for d1zcza1 (1zcz A:1-157)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1840981Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1840982Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 1841072Family c.24.1.3: Inosicase [63971] (1 protein)
  6. 1841073Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)
  7. 1841104Species Thermotoga maritima [TaxId:2336] [142081] (1 PDB entry)
    Uniprot Q9X0X6 1-157
  8. 1841105Domain d1zcza1: 1zcz A:1-157 [124923]
    Other proteins in same PDB: d1zcza2, d1zczb2
    complexed with k, pg4

Details for d1zcza1

PDB Entry: 1zcz (more details), 1.88 Å

PDB Description: crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution
PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1zcza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcza1 c.24.1.3 (A:1-157) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]}
mkrilvslyekekyldilrelhekgweiwassgtakflksngieandvstitgfenllgg
lvktlhpeifagilgpeprwdvvfvdlypppdidiggvallraaaknwkkvkpafdmetl
klaieiddeetrkylagmtfaftsvydsiranqfveg

SCOPe Domain Coordinates for d1zcza1:

Click to download the PDB-style file with coordinates for d1zcza1.
(The format of our PDB-style files is described here.)

Timeline for d1zcza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zcza2