SCOPe 2.08: Domain d1zcza1: 1zcz A:1-157

Lineage for d1zcza1 (1zcz A:1-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.3: Inosicase [63971] (1 protein)

6. Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142081] (1 PDB entry)
   Uniprot Q9X0X6 1-157

8. Domain d1zcza1: 1zcz A:1-157 [124923]
   Other proteins in same PDB: d1zcza2, d1zczb2, d1zczb3
   complexed with k, pg4

Details for d1zcza1

PDB Entry: 1zcz, 1.88 Å

PDB Description: crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution

PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1zcza1:

Sequence; same for both SEQRES and ATOM records:

>d1zcza1 c.24.1.3 (A:1-157) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]}
mkrilvslyekekyldilrelhekgweiwassgtakflksngieandvstitgfenllgg
lvktlhpeifagilgpeprwdvvfvdlypppdidiggvallraaaknwkkvkpafdmetl
klaieiddeetrkylagmtfaftsvydsiranqfveg

Timeline for d1zcza1:

• d1zcza1 first appeared in SCOP 1.73
  
• d1zcza1 appears in SCOPe 2.07