Lineage for d1zcya1 (1zcy A:1-265)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706185Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 706186Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (15 families) (S)
  5. 706581Family c.68.1.14: Glycogenin [75273] (1 protein)
  6. 706582Protein Glycogenin [75274] (1 species)
  7. 706583Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (9 PDB entries)
  8. 706588Domain d1zcya1: 1zcy A:1-265 [124922]
    complexed with so4; mutant

Details for d1zcya1

PDB Entry: 1zcy (more details), 1.99 Å

PDB Description: apo form of a mutant of glycogenin in which asp159 is replaced by ser
PDB Compounds: (A:) glycogenin-1

SCOP Domain Sequences for d1zcya1:

Sequence, based on SEQRES records: (download)

>d1zcya1 c.68.1.14 (A:1-265) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevitv
dildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereels
aapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfsggdqgllntffnswattdirk
hlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptmt
hpqflnvwwdifttsvvpllqqfgl

Sequence, based on observed residues (ATOM records): (download)

>d1zcya1 c.68.1.14 (A:1-265) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevitv
dildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereels
aapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfsggdqgllntffnswattdirk
hlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrspqflnvww
difttsvvpllqqfgl

SCOP Domain Coordinates for d1zcya1:

Click to download the PDB-style file with coordinates for d1zcya1.
(The format of our PDB-style files is described here.)

Timeline for d1zcya1: