Lineage for d1zcxa1 (1zcx A:138-301)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674681Protein Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain [141503] (1 species)
    N-terminal domain belongs to the RBD family (scop_fa 54929)
  7. 674682Species Human (Homo sapiens) [TaxId:9606] [141504] (2 PDB entries)
    structure of the N-terminal RBD is known, PDB 2cqb
  8. 674683Domain d1zcxa1: 1zcx A:138-301 [124921]

Details for d1zcxa1

PDB Entry: 1zcx (more details), 1.61 Å

PDB Description: Cyclophilin_ABH_like domain of peptidylprolyl isomerase E isoform 1 [Homo sapiens]
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOP Domain Sequences for d1zcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcxa1 b.62.1.1 (A:138-301) Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
snpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfm
cqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdw
ldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv

SCOP Domain Coordinates for d1zcxa1:

Click to download the PDB-style file with coordinates for d1zcxa1.
(The format of our PDB-style files is described here.)

Timeline for d1zcxa1:

  • d1zcxa1 is new in SCOP 1.73
  • d1zcxa1 does not appear in SCOP 1.75