Class b: All beta proteins [48724] (165 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (3 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins) |
Protein Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain [141503] (1 species) N-terminal domain belongs to the RBD family (scop_fa 54929) |
Species Human (Homo sapiens) [TaxId:9606] [141504] (2 PDB entries) structure of the N-terminal RBD is known, PDB 2cqb |
Domain d1zcxa1: 1zcx A:138-301 [124921] |
PDB Entry: 1zcx (more details), 1.61 Å
SCOP Domain Sequences for d1zcxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcxa1 b.62.1.1 (A:138-301) Peptidyl-prolyl cis-trans isomerase E, PPIE, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} snpqvymdikignkpagriqmllrsdvvpmtaenfrclcthekgfgfkgssfhriipqfm cqggdftnhngtggksiygkkfddenfilkhtgpgllsmansgpntngsqffltcdktdw ldgkhvvfgevtegldvlrqieaqgskdgkpkqkviiadcgeyv
Timeline for d1zcxa1: