SCOP 1.75: Domain d1zcwa1: 1zcw A:3-303

Lineage for d1zcwa1 (1zcw A:3-303)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.313: Antiparallel beta/alpha barrel (PT-barrel) [143491] (1 superfamily)
   tandem repeat of five alpha(2)-beta(2) motifs; antiparallel beta-sheet barrel, closed; n=10, S=10; order 123456789A; there is a channel along the barrel axis

4. Superfamily d.313.1: Prenyltransferase-like [143492] (1 family)
   the barrel channel harbours the substrate-binding site

5. Family d.313.1.1: Prenyltransferase-like [143493] (1 protein)

6. Protein Aromatic prenyltransferase [143494] (1 species)

7. Species Streptomyces sp. CL190 [TaxId:93372] [143495] (4 PDB entries)
   Uniprot Q4R2T2 3-303

8. Domain d1zcwa1: 1zcw A:3-303 [124920]
   automatically matched to 1ZB6 A:3-303
   complexed with gpp, mg, no3

Details for d1zcwa1

PDB Entry: 1zcw, 2.25 Å

PDB Description: Co-crystal structure of Orf2 an aromatic prenyl transferase from Streptomyces sp. strain CL190 complexed with GPP

PDB Compounds: (A:) Aromatic prenyltransferase

SCOP Domain Sequences for d1zcwa1:

Sequence; same for both SEQRES and ATOM records:

>d1zcwa1 d.313.1.1 (A:3-303) Aromatic prenyltransferase {Streptomyces sp. CL190 [TaxId: 93372]}
eaadvervyaameeaagllgvacardkiypllstfqdtlveggsvvvfsmasgrhsteld
fsisvptshgdpyatvvekglfpatghpvddlladtqkhlpvsmfaidgevtggfkktya
ffptdnmpgvaelsaipsmppavaenaelfarygldkvqmtsmdykkrqvnlyfselsaq
tleaesvlalvrelglhvpnelglkfckrsfsvyptlnwetgkidrlcfavisndptlvp
ssdegdiekfhnyatkapyayvgekrtlvygltlspkeeyyklgayyhitdvqrgllkaf
d

Timeline for d1zcwa1:

• d1zcwa1 first appeared in SCOP 1.73
  
• d1zcwa1 is called d1zcwa_ in SCOPe 2.01
  
• d1zcwa1 appears in the current release, SCOPe 2.08, called d1zcwa_