Lineage for d1zcwa1 (1zcw A:3-303)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741726Fold d.313: Antiparallel beta/alpha barrel (PT-barrel) [143491] (1 superfamily)
    tandem repeat of five alpha(2)-beta(2) motifs; antiparallel beta-sheet barrel, closed; n=10, S=10; order 123456789A; there is a channel along the barrel axis
  4. 741727Superfamily d.313.1: Prenyltransferase-like [143492] (1 family) (S)
    the barrel channel harbours the substrate-binding site
  5. 741728Family d.313.1.1: Prenyltransferase-like [143493] (1 protein)
  6. 741729Protein Aromatic prenyltransferase [143494] (1 species)
  7. 741730Species Streptomyces sp. CL190 [TaxId:93372] [143495] (4 PDB entries)
  8. 741734Domain d1zcwa1: 1zcw A:3-303 [124920]
    automatically matched to 1ZB6 A:3-303
    complexed with gpp, mg, no3

Details for d1zcwa1

PDB Entry: 1zcw (more details), 2.25 Å

PDB Description: Co-crystal structure of Orf2 an aromatic prenyl transferase from Streptomyces sp. strain CL190 complexed with GPP
PDB Compounds: (A:) Aromatic prenyltransferase

SCOP Domain Sequences for d1zcwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcwa1 d.313.1.1 (A:3-303) Aromatic prenyltransferase {Streptomyces sp. CL190 [TaxId: 93372]}
eaadvervyaameeaagllgvacardkiypllstfqdtlveggsvvvfsmasgrhsteld
fsisvptshgdpyatvvekglfpatghpvddlladtqkhlpvsmfaidgevtggfkktya
ffptdnmpgvaelsaipsmppavaenaelfarygldkvqmtsmdykkrqvnlyfselsaq
tleaesvlalvrelglhvpnelglkfckrsfsvyptlnwetgkidrlcfavisndptlvp
ssdegdiekfhnyatkapyayvgekrtlvygltlspkeeyyklgayyhitdvqrgllkaf
d

SCOP Domain Coordinates for d1zcwa1:

Click to download the PDB-style file with coordinates for d1zcwa1.
(The format of our PDB-style files is described here.)

Timeline for d1zcwa1: