Lineage for d1zcua1 (1zcu A:1-265)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133793Family c.68.1.14: Glycogenin [75273] (2 protein domains)
  6. 2133794Protein Glycogenin [75274] (2 species)
  7. 2133815Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75275] (15 PDB entries)
  8. 2133821Domain d1zcua1: 1zcu A:1-265 [124918]
    mutant

Details for d1zcua1

PDB Entry: 1zcu (more details), 2 Å

PDB Description: apo form of the 162S mutant of glycogenin
PDB Compounds: (A:) glycogenin-1

SCOPe Domain Sequences for d1zcua1:

Sequence, based on SEQRES records: (download)

>d1zcua1 c.68.1.14 (A:1-265) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevitv
dildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereels
aapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggsqgllntffnswattdirk
hlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrseghdptmt
hpqflnvwwdifttsvvpllqqfgl

Sequence, based on observed residues (ATOM records): (download)

>d1zcua1 c.68.1.14 (A:1-265) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tdqafvtlttndayakgalvlgsslkqhrtsrrlavlttpqvsdtmrkaleivfdevitv
dildsgdsahltlmkrpelgvtltklhcwsltqyskcvfmdadtlvlaniddlfereels
aapdpgwpdcfnsgvfvyqpsvetynqllhvaseqgsfdggsqgllntffnswattdirk
hlpfiynlssisiysylpafkafganakvvhflgqtkpwnytydtktksvrsmthpqfln
vwwdifttsvvpllqqfgl

SCOPe Domain Coordinates for d1zcua1:

Click to download the PDB-style file with coordinates for d1zcua1.
(The format of our PDB-style files is described here.)

Timeline for d1zcua1: