Lineage for d1zcma1 (1zcm A:33-353)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715453Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
  6. 715454Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
    includes the N-terminal 'sequence' domain I
  7. 715460Species Human(Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries)
  8. 715461Domain d1zcma1: 1zcm A:33-353 [124909]
    complexed with c1n, ca; mutant

Details for d1zcma1

PDB Entry: 1zcm (more details), 2 Å

PDB Description: human calpain protease core inhibited by zllych2f
PDB Compounds: (A:) Calpain 1, large [catalytic] subunit

SCOP Domain Sequences for d1zcma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcma1 d.3.1.3 (A:33-353) Calpain large subunit, catalytic domain (domain II) {Human(Homo sapiens), mu type [TaxId: 9606]}
naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq
lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse
afedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh
aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg
efwmsfrdfmreftrleicnl

SCOP Domain Coordinates for d1zcma1:

Click to download the PDB-style file with coordinates for d1zcma1.
(The format of our PDB-style files is described here.)

Timeline for d1zcma1: