SCOPe 2.08: Domain d1zcma1: 1zcm A:33-353

Lineage for d1zcma1 (1zcm A:33-353)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
   automatically mapped to Pfam PF00648

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
   includes the N-terminal 'sequence' domain I

7. Species Human (Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries)
   Uniprot P07384 33-353! Uniprot P07384 33-354

8. Domain d1zcma1: 1zcm A:33-353 [124909]
   complexed with c1n, ca

Details for d1zcma1

PDB Entry: 1zcm, 2 Å

PDB Description: human calpain protease core inhibited by zllych2f

PDB Compounds: (A:) Calpain 1, large [catalytic] subunit

SCOPe Domain Sequences for d1zcma1:

Sequence; same for both SEQRES and ATOM records:

>d1zcma1 d.3.1.3 (A:33-353) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), mu type [TaxId: 9606]}
naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq
lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse
afedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh
aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg
efwmsfrdfmreftrleicnl

Timeline for d1zcma1:

• d1zcma1 first appeared in SCOP 1.73
  
• d1zcma1 appears in SCOPe 2.07