Lineage for d1zcea1 (1zce A:2-147)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432970Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
    Pfam PF01878; DUF55
  6. 2432971Protein Hypothetical protein Atu2648 [141712] (1 species)
  7. 2432972Species Agrobacterium tumefaciens [TaxId:358] [141713] (1 PDB entry)
    Uniprot Q8UC50 2-147
  8. 2432973Domain d1zcea1: 1zce A:2-147 [124907]

Details for d1zcea1

PDB Entry: 1zce (more details), 1.3 Å

PDB Description: X-Ray Crystal Structure of Protein Atu2648 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR33.
PDB Compounds: (A:) hypothetical protein Atu2648

SCOPe Domain Sequences for d1zcea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcea1 b.122.1.8 (A:2-147) Hypothetical protein Atu2648 {Agrobacterium tumefaciens [TaxId: 358]}
anywlyksepfkwswemqkakgetgeewtgvrnyqarnnmramkigdkgffyhsnegldv
vgivevcalshpdstaegdlkwdcvdiravcdmpqpvslkdvkanpklekmslvtsmrls
vqpvteeeylevcrmgglanppkspd

SCOPe Domain Coordinates for d1zcea1:

Click to download the PDB-style file with coordinates for d1zcea1.
(The format of our PDB-style files is described here.)

Timeline for d1zcea1: