![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins) Pfam PF01878; DUF55 |
![]() | Protein Hypothetical protein Atu2648 [141712] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [141713] (1 PDB entry) Uniprot Q8UC50 2-147 |
![]() | Domain d1zcea1: 1zce A:2-147 [124907] |
PDB Entry: 1zce (more details), 1.3 Å
SCOPe Domain Sequences for d1zcea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcea1 b.122.1.8 (A:2-147) Hypothetical protein Atu2648 {Agrobacterium tumefaciens [TaxId: 358]} anywlyksepfkwswemqkakgetgeewtgvrnyqarnnmramkigdkgffyhsnegldv vgivevcalshpdstaegdlkwdcvdiravcdmpqpvslkdvkanpklekmslvtsmrls vqpvteeeylevcrmgglanppkspd
Timeline for d1zcea1: