Lineage for d1zcce_ (1zcc E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839940Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
    Pfam PF03009
  6. 2839958Protein automated matches [190795] (2 species)
    not a true protein
  7. 2839959Species Agrobacterium tumefaciens [TaxId:176299] [188183] (1 PDB entry)
  8. 2839963Domain d1zcce_: 1zcc E: [124905]
    Other proteins in same PDB: d1zcca1
    automated match to d1zcca1
    complexed with act, so4

Details for d1zcce_

PDB Entry: 1zcc (more details), 2.5 Å

PDB Description: crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58
PDB Compounds: (E:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d1zcce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcce_ c.1.18.3 (E:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mtkivshrganrfapentfaaadlalqqgadyieldvresadgvlyvihdetldrttngt
gpvghmlsseidtldaggwfddrfkgaivprldaylehlrgragvyielkycdpakvaal
vrhlgmvrdtfyfsfseemrqglqsiapefrrmmtldiakspslvgavhhasiieitpaq
mrrpgiieasrkagleimvyyggddmavhreiatsdvdyinldrpdlfaavrs

SCOPe Domain Coordinates for d1zcce_:

Click to download the PDB-style file with coordinates for d1zcce_.
(The format of our PDB-style files is described here.)

Timeline for d1zcce_: