SCOPe 2.08: Domain d1zcce_: 1zcc E:

Lineage for d1zcce_ (1zcc E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (5 proteins)
   Pfam PF03009

6. Protein automated matches [190795] (2 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [188183] (1 PDB entry)

8. Domain d1zcce_: 1zcc E: [124905]
   Other proteins in same PDB: d1zcca1
   automated match to d1zcca1
   complexed with act, so4

Details for d1zcce_

PDB Entry: 1zcc, 2.5 Å

PDB Description: crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58

PDB Compounds: (E:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d1zcce_:

Sequence; same for both SEQRES and ATOM records:

>d1zcce_ c.1.18.3 (E:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mtkivshrganrfapentfaaadlalqqgadyieldvresadgvlyvihdetldrttngt
gpvghmlsseidtldaggwfddrfkgaivprldaylehlrgragvyielkycdpakvaal
vrhlgmvrdtfyfsfseemrqglqsiapefrrmmtldiakspslvgavhhasiieitpaq
mrrpgiieasrkagleimvyyggddmavhreiatsdvdyinldrpdlfaavrs

Timeline for d1zcce_:

• d1zcce_ first appeared in SCOP 1.73, called d1zcce1
  
• d1zcce_ appears in SCOPe 2.07