Lineage for d1zccc1 (1zcc C:1-234)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818986Superfamily c.1.18: PLC-like phosphodiesterases [51695] (3 families) (S)
  5. 819029Family c.1.18.3: Glycerophosphoryl diester phosphodiesterase [89508] (4 proteins)
    Pfam PF03009
  6. 819038Protein Glycerophosphodiester phosphodiesterase UgpQ [141866] (1 species)
  7. 819039Species Agrobacterium tumefaciens [TaxId:358] [141867] (1 PDB entry)
    Uniprot Q8U887 1-240
  8. 819041Domain d1zccc1: 1zcc C:1-234 [124904]
    automatically matched to 1ZCC A:1-240
    complexed with act, so4

Details for d1zccc1

PDB Entry: 1zcc (more details), 2.5 Å

PDB Description: crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58
PDB Compounds: (C:) glycerophosphodiester phosphodiesterase

SCOP Domain Sequences for d1zccc1:

Sequence, based on SEQRES records: (download)

>d1zccc1 c.1.18.3 (C:1-234) Glycerophosphodiester phosphodiesterase UgpQ {Agrobacterium tumefaciens [TaxId: 358]}
mtkivshrganrfapentfaaadlalqqgadyieldvresadgvlyvihdetldrttngt
gpvghmlsseidtldaggwfddrfkgaivprldaylehlrgragvyielkycdpakvaal
vrhlgmvrdtfyfsfseemrqglqsiapefrrmmtldiakspslvgavhhasiieitpaq
mrrpgiieasrkagleimvyyggddmavhreiatsdvdyinldrpdlfaavrsg

Sequence, based on observed residues (ATOM records): (download)

>d1zccc1 c.1.18.3 (C:1-234) Glycerophosphodiester phosphodiesterase UgpQ {Agrobacterium tumefaciens [TaxId: 358]}
mtkivshrganrfapentfaaadlalqqgadyieldvresadgvlyvihdetldrttngt
gpvghmlsseidtldaggwfddrfgaivprldaylehlrgragvyielkycdpakvaalv
rhlgmvrdtfyfsfseemrqglqsiapefrrmmtldiakspslvgavhhasiieitpaqm
rrpgiieasrkagleimvyyggddmavhreiatsdvdyinldrpdlfaavrsg

SCOP Domain Coordinates for d1zccc1:

Click to download the PDB-style file with coordinates for d1zccc1.
(The format of our PDB-style files is described here.)

Timeline for d1zccc1: