Lineage for d1zcba1 (1zcb A:76-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002645Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2002646Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2002647Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2002648Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2002690Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries)
    Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201
  8. 2002691Domain d1zcba1: 1zcb A:76-201 [124901]
    Other proteins in same PDB: d1zcba2, d1zcba3
    G alpha i/13
    complexed with gdp

Details for d1zcba1

PDB Entry: 1zcb (more details), 2 Å

PDB Description: crystal structure of g alpha 13 in complex with gdp
PDB Compounds: (A:) G alpha i/13

SCOPe Domain Sequences for d1zcba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illarr

SCOPe Domain Coordinates for d1zcba1:

Click to download the PDB-style file with coordinates for d1zcba1.
(The format of our PDB-style files is described here.)

Timeline for d1zcba1: