Class a: All alpha proteins [46456] (290 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries) Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201 |
Domain d1zcab1: 1zca B:83-204 [124899] Other proteins in same PDB: d1zcaa2, d1zcab2 automated match to d1zcaa1 complexed with alf, gdp, mg |
PDB Entry: 1zca (more details), 2.9 Å
SCOPe Domain Sequences for d1zcab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcab1 a.66.1.1 (B:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} fdqkallefrdtifdnilkgsrvlvdardklgipwqhsenekhgmflmafenkaglpvep atfqlyvpalsalwrdsgireafsrrsefqlgesvkyfldnldrigqlnyfpskqdilla rk
Timeline for d1zcab1: